Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) |
Family d.38.1.1: 4HBT-like [54638] (19 proteins) Pfam PF03061 |
Protein Hypothetical protein PA2801 [143162] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [143163] (2 PDB entries) Uniprot Q9I042 5-134 |
Domain d2alia_: 2ali A: [303509] automated match to d3qy3a1 complexed with cl |
PDB Entry: 2ali (more details), 1.75 Å
SCOPe Domain Sequences for d2alia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2alia_ d.38.1.1 (A:) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]} qllhtahipvrwgdmdsyghvnntlyfqyleearvawfetlgidlegaaegpvvlqslht ylkpvvhpatvvvelyagrlgtsslvlehrlhtledpqgtygeghcklvwvrhaenrstp vpdsiraaia
Timeline for d2alia_: