PDB entry 2ali

View 2ali on RCSB PDB site
Description: Structure of Protein of Unknown Function PA2801 from Pseudomonas aeruginosa, Putative Thioesterase
Class: structural genomics, unknown function
Keywords: structural genomics, PA2801, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-08-05, released 2005-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.178
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA2801
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA2801
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I042 (Start-155)
      • modified residue (40)
    Domains in SCOPe 2.08: d2alia_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aliA (A:)
    mgsshhhhhhssgrenlyfqghmadrqllhtahipvrwgdmdsyghvnntlyfqyleear
    vawfetlgidlegaaegpvvlqslhtylkpvvhpatvvvelyagrlgtsslvlehrlhtl
    edpqgtygeghcklvwvrhaenrstpvpdsiraaiags
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aliA (A:)
    qllhtahipvrwgdmdsyghvnntlyfqyleearvawfetlgidlegaaegpvvlqslht
    ylkpvvhpatvvvelyagrlgtsslvlehrlhtledpqgtygeghcklvwvrhaenrstp
    vpdsiraaia