SCOPe 2.07: Domain d1xvhb3: 1xvh B:4-72

Lineage for d1xvhb3 (1xvh B:4-72)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families)

5. Family a.8.1.2: GA module, an albumin-binding domain [47001] (4 proteins)
   Pfam PF01468; also includes FIVAR module, Pfam PF07554

6. Protein Ebh protein [116850] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [116851] (2 PDB entries)
   Uniprot Q8NWQ6 3912-4037

8. Domain d1xvhb3: 1xvh B:4-72 [303378]
   Other proteins in same PDB: d1xvha5, d1xvhb5
   automated match to d4kjma1
   complexed with act, zn

Details for d1xvhb3

PDB Entry: 1xvh, 2 Å

PDB Description: Crystal structure of the Staphylococcus aureus protein (NP_646141.1, domain 3912-4037) similar to streptococcal adhesins emb and ebhA/ebhB.

PDB Compounds: (B:) hypothetical protein, similar to streptococcal adhesin emb

SCOPe Domain Sequences for d1xvhb3:

Sequence, based on SEQRES records:

>d1xvhb3 a.8.1.2 (B:4-72) Ebh protein {Staphylococcus aureus [TaxId: 1280]}
mgnlqtaindksgtlasqnfldadeqkrnaynqavsaaetilnkqtgpntaktaveqaln
nvnnakhal

Sequence, based on observed residues (ATOM records):

>d1xvhb3 a.8.1.2 (B:4-72) Ebh protein {Staphylococcus aureus [TaxId: 1280]}
mgnlqtaindksgtlasqnfldadeqkrnaynqavsaaetilaktaveqalnnvnnakha
l

Timeline for d1xvhb3:

• d1xvhb3 first appeared in SCOPe 2.06
  
• d1xvhb3 appears in the current release, SCOPe 2.08