![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.256: RUN domain-like [140740] (1 superfamily) multihelical; 3-helical bundle similar to one half of the DEATH domain fold is flanked by two alpha-hairpins forming a four-helical bundle; the axes of the three-helical and four-helical bundles are aproximately orthogonal to each other |
![]() | Superfamily a.256.1: RUN domain-like [140741] (1 family) ![]() |
![]() | Family a.256.1.1: RUN domain [140742] (2 proteins) Pfam PF02759 |
![]() | Protein automated matches [190616] (1 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187644] (2 PDB entries) |
![]() | Domain d1wusa_: 1wus A: [303327] automated match to d2dwka_ |
PDB Entry: 1wus (more details), 2.18 Å
SCOPe Domain Sequences for d1wusa_:
Sequence, based on SEQRES records: (download)
>d1wusa_ a.256.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} manermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglkakktflg qnksfwgplelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkklseymkali nkkellsefyevnalmmeeegaiiagllvglnvidanfcmkgedldsqv
>d1wusa_ a.256.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} manermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglkanksfwg plelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkklseymkalinkkells efyevnalmmeeegaiiagllvglnvidanfcmkgedldsqv
Timeline for d1wusa_: