Lineage for d1wusa_ (1wus A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2020393Fold a.256: RUN domain-like [140740] (1 superfamily)
    multihelical; 3-helical bundle similar to one half of the DEATH domain fold is flanked by two alpha-hairpins forming a four-helical bundle; the axes of the three-helical and four-helical bundles are aproximately orthogonal to each other
  4. 2020394Superfamily a.256.1: RUN domain-like [140741] (1 family) (S)
  5. 2020395Family a.256.1.1: RUN domain [140742] (2 proteins)
    Pfam PF02759
  6. 2020400Protein automated matches [190616] (1 species)
    not a true protein
  7. 2020401Species Mouse (Mus musculus) [TaxId:10090] [187644] (2 PDB entries)
  8. 2020403Domain d1wusa_: 1wus A: [303327]
    automated match to d2dwka_

Details for d1wusa_

PDB Entry: 1wus (more details), 2.18 Å

PDB Description: Crystal structure of the conserved domain of MS0278
PDB Compounds: (A:) rap2 interacting protein x

SCOPe Domain Sequences for d1wusa_:

Sequence, based on SEQRES records: (download)

>d1wusa_ a.256.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
manermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglkakktflg
qnksfwgplelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkklseymkali
nkkellsefyevnalmmeeegaiiagllvglnvidanfcmkgedldsqv

Sequence, based on observed residues (ATOM records): (download)

>d1wusa_ a.256.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
manermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglkanksfwg
plelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkklseymkalinkkells
efyevnalmmeeegaiiagllvglnvidanfcmkgedldsqv

SCOPe Domain Coordinates for d1wusa_:

Click to download the PDB-style file with coordinates for d1wusa_.
(The format of our PDB-style files is described here.)

Timeline for d1wusa_: