Lineage for d1vgsi_ (1vgs I:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2485379Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2485823Protein automated matches [190100] (20 species)
    not a true protein
  7. 2485824Species Aeropyrum pernix [311183] (1 PDB entry)
  8. 2485832Domain d1vgsi_: 1vgs I: [303233]
    automated match to d3a5wa_
    complexed with ipa, mes

Details for d1vgsi_

PDB Entry: 1vgs (more details), 2.31 Å

PDB Description: Crystal Structure of Peroxiredoxin from an Aerobic Hyperthermophilic Crenarchaeon Aeropyrum pernix K1
PDB Compounds: (I:) peroxiredoxin

SCOPe Domain Sequences for d1vgsi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgsi_ c.47.1.10 (I:) automated matches {Aeropyrum pernix}
pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarry
edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa
thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii
geglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakll
y

SCOPe Domain Coordinates for d1vgsi_:

Click to download the PDB-style file with coordinates for d1vgsi_.
(The format of our PDB-style files is described here.)

Timeline for d1vgsi_: