Lineage for d1cqjd1 (1cqj D:1-121)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 978107Family c.2.1.8: CoA-binding domain [51900] (6 proteins)
  6. 978124Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (3 species)
  7. 978125Species Escherichia coli [TaxId:562] [51902] (11 PDB entries)
  8. 978137Domain d1cqjd1: 1cqj D:1-121 [30306]
    Other proteins in same PDB: d1cqja2, d1cqjb1, d1cqjb2, d1cqjd2, d1cqje1, d1cqje2
    complexed with coa, po4

Details for d1cqjd1

PDB Entry: 1cqj (more details), 2.9 Å

PDB Description: crystal structure of dephosphorylated e. coli succinyl-coa synthetase
PDB Compounds: (D:) succinyl-coa synthetase alpha chain

SCOPe Domain Sequences for d1cqjd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqjd1 c.2.1.8 (D:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]}
silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
p

SCOPe Domain Coordinates for d1cqjd1:

Click to download the PDB-style file with coordinates for d1cqjd1.
(The format of our PDB-style files is described here.)

Timeline for d1cqjd1: