Lineage for d2scua1 (2scu A:1-121)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 978107Family c.2.1.8: CoA-binding domain [51900] (6 proteins)
  6. 978124Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (3 species)
  7. 978125Species Escherichia coli [TaxId:562] [51902] (11 PDB entries)
  8. 978134Domain d2scua1: 2scu A:1-121 [30303]
    Other proteins in same PDB: d2scua2, d2scub1, d2scub2, d2scud2, d2scue1, d2scue2
    complexed with coa, so4

Details for d2scua1

PDB Entry: 2scu (more details), 2.3 Å

PDB Description: A detailed description of the structure of Succinyl-COA synthetase from Escherichia coli
PDB Compounds: (A:) protein (succinyl-coa ligase)

SCOPe Domain Sequences for d2scua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2scua1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]}
silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
p

SCOPe Domain Coordinates for d2scua1:

Click to download the PDB-style file with coordinates for d2scua1.
(The format of our PDB-style files is described here.)

Timeline for d2scua1: