Lineage for d1efkd1 (1efk D:280-573)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) 
Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins) 
Protein Mitochondrial NAD(P)-dependenent malic enzyme [51898] (1 species) Species Human (Homo sapiens) [TaxId:9606] [51899] (4 PDB entries) 
Domain d1efkd1: 1efk D:280-573 [30302]
Other proteins in same PDB: d1efka2, d1efkb2, d1efkc2, d1efkd2
Details for d1efkd1
PDB Entry: 1efk (more details), 2.6 Å
PDB Description: structure of human malic enzyme in complex with ketomalonate
SCOP Domain Sequences for d1efkd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efkd1 c.2.1.7 (D:280-573) Mitochondrial NAD(P)-dependenent malic enzyme {Human (Homo sapiens)}
iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk
kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf
tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv
ftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsqltdeelaqgrlypplani
qevsiniaikvteylyankmafrypepedkakyvkertwrseydsllpdvyewp
SCOP Domain Coordinates for d1efkd1:
Click to download the PDB-style file with coordinates for d1efkd1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1efkd1:
View in 3D
