SCOPe 2.08: Domain d1og8b4: 1og8 B:254-406

Lineage for d1og8b4 (1og8 B:254-406)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Beta-ketoacyl-ACP synthase I, C-terminal domain [419015] (2 species)

7. Species Escherichia coli [TaxId:562] [419487] (19 PDB entries)
   Uniprot P14926

8. Domain d1og8b4: 1og8 B:254-406 [302839]
   Other proteins in same PDB: d1og8a3, d1og8b3, d1og8c3, d1og8d3
   automated match to d1fj4a2
   complexed with hyd, nh4
   has additional insertions and/or extensions that are not grouped together

Details for d1og8b4

PDB Entry: 1og8, 1.9 Å

PDB Description: e. coli beta-ketoacyl [acyl carrier protein] synthase i, 120 k

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d1og8b4:

Sequence; same for both SEQRES and ATOM records:

>d1og8b4 c.95.1.1 (B:254-406) Beta-ketoacyl-ACP synthase I, C-terminal domain {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd

Timeline for d1og8b4:

• d1og8b4 first appeared in SCOPe 2.06
  
• d1og8b4 appears in SCOPe 2.07