Lineage for d1og8a4 (1og8 A:254-406)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916471Family c.95.1.1: Thiolase-related [53902] (20 proteins)
  6. 2916496Protein Beta-ketoacyl-ACP synthase I, C-terminal domain [419015] (2 species)
  7. 2916497Species Escherichia coli [TaxId:562] [419487] (19 PDB entries)
    Uniprot P14926
  8. 2916510Domain d1og8a4: 1og8 A:254-406 [302837]
    Other proteins in same PDB: d1og8a3, d1og8b3, d1og8c3, d1og8d3
    automated match to d1fj4a2
    complexed with hyd, nh4

    has additional insertions and/or extensions that are not grouped together

Details for d1og8a4

PDB Entry: 1og8 (more details), 1.9 Å

PDB Description: e. coli beta-ketoacyl [acyl carrier protein] synthase i, 120 k
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d1og8a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1og8a4 c.95.1.1 (A:254-406) Beta-ketoacyl-ACP synthase I, C-terminal domain {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd

SCOPe Domain Coordinates for d1og8a4:

Click to download the PDB-style file with coordinates for d1og8a4.
(The format of our PDB-style files is described here.)

Timeline for d1og8a4: