Lineage for d1m50a_ (1m50 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2422439Fold b.75: Bacteriochlorophyll A protein [51080] (1 superfamily)
    single sheet; 16 strands; meander
  4. 2422440Superfamily b.75.1: Bacteriochlorophyll A protein [51081] (1 family) (S)
    automatically mapped to Pfam PF02327
  5. 2422441Family b.75.1.1: Bacteriochlorophyll A protein [51082] (2 proteins)
  6. 2422442Protein Bacteriochlorophyll A protein [51083] (2 species)
  7. 2422443Species Chlorobium tepidum [TaxId:1097] [51085] (2 PDB entries)
  8. 2422446Domain d1m50a_: 1m50 A: [302721]
    automated match to d3enia_
    complexed with bcl, flc

Details for d1m50a_

PDB Entry: 1m50 (more details), 2.2 Å

PDB Description: Crystal Structure Of The Bacteriochlorophyll A Protein From Chlorobium Tepidum
PDB Compounds: (A:) Bacteriochlorophyll a protein

SCOPe Domain Sequences for d1m50a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m50a_ b.75.1.1 (A:) Bacteriochlorophyll A protein {Chlorobium tepidum [TaxId: 1097]}
ttahsdyeivleggssswgkvkarakvnappaspllpadcdvklnvkpldpakgfvrisa
vfesivdstknkltieadianetkerrisvgegmvsvgdfshtfsfegsvvnlfyyrsda
vrrnvpnpiymqgrqfhdilmkvpldnndlidtwegtvkaigstgafndwirdfwfigpa
ftalneggqrisrievnglntesgpkgpvgvsrwrfshggsgmvdsisrwaelfpsdkln
rpaqveagfrsdsqgievkvdgefpgvsvdaggglrrilnhpliplvhhgmvgkfnnfnv
daqlkvvlpkgykiryaapqyrsqnleeyrwsggayarwvehvckggvgqfeilyaq

SCOPe Domain Coordinates for d1m50a_:

Click to download the PDB-style file with coordinates for d1m50a_.
(The format of our PDB-style files is described here.)

Timeline for d1m50a_: