Lineage for d1liwc5 (1liw C:160-261)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804062Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 2804063Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 2804064Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 2804065Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 2804086Species Human (Homo sapiens) [TaxId:9606] [82151] (8 PDB entries)
  8. 2804106Domain d1liwc5: 1liw C:160-261 [302691]
    Other proteins in same PDB: d1liwa4, d1liwa6, d1liwb4, d1liwb5, d1liwc4, d1liwc6
    automated match to d2vgfa1
    complexed with fbp, k, mn, pga; mutant

Details for d1liwc5

PDB Entry: 1liw (more details), 2.75 Å

PDB Description: Human erythrocyte pyruvate kinase: Thr384Met mutant
PDB Compounds: (C:) Pyruvate kinase, isozymes R/L

SCOPe Domain Sequences for d1liwc5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1liwc5 b.58.1.1 (C:160-261) Pyruvate kinase (PK) {Human (Homo sapiens) [TaxId: 9606]}
peirtgilqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyi
ddglislvvqkigpeglvtqvenggvlgsrkgvnlpgaqvdl

SCOPe Domain Coordinates for d1liwc5:

Click to download the PDB-style file with coordinates for d1liwc5.
(The format of our PDB-style files is described here.)

Timeline for d1liwc5: