Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) |
Family c.1.12.1: Pyruvate kinase [51622] (1 protein) |
Protein Pyruvate kinase, N-terminal domain [51623] (6 species) this domain is interrupted by an all-beta domain C-terminal domain is alpha/beta |
Species Human (Homo sapiens) [TaxId:9606] [82273] (8 PDB entries) |
Domain d1liwc4: 1liw C:57-159,C:262-439 [302690] Other proteins in same PDB: d1liwa5, d1liwa6, d1liwb5, d1liwc5, d1liwc6 automated match to d2vgfa2 complexed with fbp, k, mn, pga; mutant |
PDB Entry: 1liw (more details), 2.75 Å
SCOPe Domain Sequences for d1liwc4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1liwc4 c.1.12.1 (C:57-159,C:262-439) Pyruvate kinase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgXpglseqdvrdlrfgve hgvdivfasfvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvar gdlgieipaekvflaqkmmigrcnlagkpvvcatqmlesmitkprpmraetsdvanavld gadcimlsgetakgnfpveavkmqhaiareaeaavyhrqlfe
Timeline for d1liwc4: