SCOPe 2.02: Domain d1lehb1: 1leh B:135-364

Lineage for d1lehb1 (1leh B:135-364)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Leucine dehydrogenase [51890] (1 species)

7. Species Bacillus sphaericus [TaxId:1421] [51891] (1 PDB entry)

8. Domain d1lehb1: 1leh B:135-364 [30269]
   Other proteins in same PDB: d1leha2, d1lehb2

Details for d1lehb1

PDB Entry: 1leh, 2.2 Å

PDB Description: leucine dehydrogenase from bacillus sphaericus

PDB Compounds: (B:) leucine dehydrogenase

SCOPe Domain Sequences for d1lehb1:

Sequence; same for both SEQRES and ATOM records:

>d1lehb1 c.2.1.7 (B:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]}
gispafgssgnpspvtaygvyrgmkaaakeafgsdsleglavsvqglgnvakalckklnt
egaklvvtdvnkaavsaavaeegadavapnaiygvtcdifapcalgavlndftipqlkak
viagsadnqlkdprhgkylhelgivyapdyvinaggvinvadelygynrtramkrvdgiy
dsiekifaiskrdgvpsyvaadrmaeeriakvakarsqflqdqrnilngr

Timeline for d1lehb1:

• d1lehb1 first appeared (with stable ids) in SCOP 1.55
  
• d1lehb1 appears in SCOPe 2.01
  
• d1lehb1 appears in SCOPe 2.03
  
• d1lehb1 appears in the current release, SCOPe 2.08