Lineage for d1liwa6 (1liw A:440-573)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488765Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 2488766Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 2488767Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
    automatically mapped to Pfam PF02887
  6. 2488768Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 2488789Species Human (Homo sapiens) [TaxId:9606] [82431] (8 PDB entries)
  8. 2488806Domain d1liwa6: 1liw A:440-573 [302687]
    Other proteins in same PDB: d1liwa4, d1liwa5, d1liwb4, d1liwc4, d1liwc5
    automated match to d2vgfa3
    complexed with fbp, k, mn, pga; mutant

Details for d1liwa6

PDB Entry: 1liw (more details), 2.75 Å

PDB Description: Human erythrocyte pyruvate kinase: Thr384Met mutant
PDB Compounds: (A:) Pyruvate kinase, isozymes R/L

SCOPe Domain Sequences for d1liwa6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1liwa6 c.49.1.1 (A:440-573) Pyruvate kinase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
elrraaplsrdptevtaigaveaafkccaaaiivltttgrsaqllsryrpraaviavtrs
aqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwr
pgsgytnimrvlsi

SCOPe Domain Coordinates for d1liwa6:

Click to download the PDB-style file with coordinates for d1liwa6.
(The format of our PDB-style files is described here.)

Timeline for d1liwa6: