Lineage for d1kaua_ (1kau A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536035Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 2536036Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) (S)
  5. 2536037Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
    automatically mapped to Pfam PF00547
  6. 2536038Protein Urease, gamma-subunit [54113] (4 species)
  7. 2536057Species Klebsiella aerogenes [TaxId:28451] [54114] (28 PDB entries)
  8. 2536077Domain d1kaua_: 1kau A: [302626]
    Other proteins in same PDB: d1kaub_, d1kauc1, d1kauc2
    automated match to d1ejxa_
    complexed with cbx, ni

Details for d1kaua_

PDB Entry: 1kau (more details), 2.2 Å

PDB Description: the crystal structure of urease from klebsiella aerogenes at 2.2 angstroms resolution
PDB Compounds: (A:) klebsiella aerogenes urease

SCOPe Domain Sequences for d1kaua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kaua_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes [TaxId: 28451]}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

SCOPe Domain Coordinates for d1kaua_:

Click to download the PDB-style file with coordinates for d1kaua_.
(The format of our PDB-style files is described here.)

Timeline for d1kaua_: