Lineage for d1hwza1 (1hwz A:209-501)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 688318Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 688319Protein Glutamate dehydrogenase [51884] (8 species)
  7. 688345Species Cow (Bos taurus) [TaxId:9913] [51889] (5 PDB entries)
  8. 688376Domain d1hwza1: 1hwz A:209-501 [30256]
    Other proteins in same PDB: d1hwza2, d1hwzb2, d1hwzc2, d1hwzd2, d1hwze2, d1hwzf2

Details for d1hwza1

PDB Entry: 1hwz (more details), 2.8 Å

PDB Description: bovine glutamate dehydrogenase complexed with nadph, glutamate, and gtp
PDB Compounds: (A:) glutamate dehydrogenase

SCOP Domain Sequences for d1hwza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwza1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
hgrisatgrgvfhgienfienasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfga
kcvavgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpqadkiflernimvipdlylnaggvtvsyfqilkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft

SCOP Domain Coordinates for d1hwza1:

Click to download the PDB-style file with coordinates for d1hwza1.
(The format of our PDB-style files is described here.)

Timeline for d1hwza1: