Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins) dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet |
Protein Glutamate dehydrogenase [53225] (8 species) |
Species Cow (Bos taurus) [TaxId:9913] [53230] (8 PDB entries) |
Domain d1hwxe3: 1hwx E:1-208 [302498] Other proteins in same PDB: d1hwxa4, d1hwxb4, d1hwxc4, d1hwxd4, d1hwxe4, d1hwxf4 automated match to d1hwza2 complexed with glu, gtp, nai |
PDB Entry: 1hwx (more details), 2.5 Å
SCOPe Domain Sequences for d1hwxe3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hwxe3 c.58.1.1 (E:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia dtyastighydinahacvtgkpisqggi
Timeline for d1hwxe3: