Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein Endoglucanase Cel5a [51499] (4 species) |
Species Bacillus agaradhaerens [TaxId:76935] [51500] (21 PDB entries) Uniprot O85465 30-329 |
Domain d1hf5a_: 1hf5 A: [302471] automated match to d7a3ha_ complexed with fct, gol, so4 |
PDB Entry: 1hf5 (more details), 1.1 Å
SCOPe Domain Sequences for d1hf5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hf5a_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires
Timeline for d1hf5a_: