SCOPe 2.06: Domain d1hf5a_: 1hf5 A:

Lineage for d1hf5a_ (1hf5 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Endoglucanase Cel5a [51499] (4 species)

7. Species Bacillus agaradhaerens [TaxId:76935] [51500] (21 PDB entries)
   Uniprot O85465 30-329

8. Domain d1hf5a_: 1hf5 A: [302471]
   automated match to d7a3ha_
   complexed with fct, gol, so4

Details for d1hf5a_

PDB Entry: 1hf5, 1.1 Å

PDB Description: 2-deoxy-2-fluro-b-d-cellotriosyl/enzyme intermediate complex of the endoglucanase cel5a from bacillus agaradhearans at 1.08 angstrom resolution

PDB Compounds: (A:) endoglucanase b

SCOPe Domain Sequences for d1hf5a_:

Sequence; same for both SEQRES and ATOM records:

>d1hf5a_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]}
svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires

Timeline for d1hf5a_:

• d1hf5a_ is new in SCOPe 2.06-stable
  
• d1hf5a_ appears in SCOPe 2.07
  
• d1hf5a_ appears in the current release, SCOPe 2.08