Lineage for d1gmsa_ (1gms A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988341Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
    has slightly different topology than other families do
  6. 2988387Protein Glucosamine 6-phosphate synthase, N-terminal domain [56237] (1 species)
  7. 2988388Species Escherichia coli [TaxId:562] [56238] (7 PDB entries)
    Uniprot P17169 1-238
  8. 2988392Domain d1gmsa_: 1gms A: [302431]
    automated match to d1xffa_
    complexed with act, hga, na

Details for d1gmsa_

PDB Entry: 1gms (more details), 1.85 Å

PDB Description: glutaminase domain of glucosamine 6-phosphate synthase complexed with l-glu hydroxamate
PDB Compounds: (A:) glucosamine 6-phosphate synthase

SCOPe Domain Sequences for d1gmsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gmsa_ d.153.1.1 (A:) Glucosamine 6-phosphate synthase, N-terminal domain {Escherichia coli [TaxId: 562]}
cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnl

SCOPe Domain Coordinates for d1gmsa_:

Click to download the PDB-style file with coordinates for d1gmsa_.
(The format of our PDB-style files is described here.)

Timeline for d1gmsa_: