Lineage for d1fxma_ (1fxm A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831125Protein Xylanase A, catalytic core [51514] (8 species)
  7. 2831205Species Thermoascus aurantiacus [TaxId:5087] [51518] (11 PDB entries)
  8. 2831208Domain d1fxma_: 1fxm A: [302415]
    automated match to d1k6aa_

Details for d1fxma_

PDB Entry: 1fxm (more details), 1.14 Å

PDB Description: crystal structure of the thermoascus aurantiacus xylanase i
PDB Compounds: (A:) xylanase I

SCOPe Domain Sequences for d1fxma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxma_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus [TaxId: 5087]}
qaaqsvdqlikargkvyfgvatdqnrlttgknaaiiqadfgqvtpensmkwdatepsqgn
fnfagadylvnwaqqngklirghtlvwhsqlpswvssitdkntltnvmknhittlmtryk
gkirawdvvneafnedgslrqtvflnvigedyipiafqtaraadpnaklyindynldsas
ypktqaivnrvkqwraagvpidgigsqthlsagqgagvlqalpllasagtpevaiteldv
agasptdyvnvvnaclnvqscvgitvwgvadpdswrasttpllfdgnfnpkpaynaivqd
lq

SCOPe Domain Coordinates for d1fxma_:

Click to download the PDB-style file with coordinates for d1fxma_.
(The format of our PDB-style files is described here.)

Timeline for d1fxma_: