Lineage for d1e6tc_ (1e6t C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203937Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 2203938Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 2203939Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 2203988Protein MS2 virus coat protein [55407] (1 species)
  7. 2203989Species Bacteriophage MS2 [TaxId:12022] [55408] (36 PDB entries)
    Uniprot P03612
  8. 2203992Domain d1e6tc_: 1e6t C: [302372]
    automated match to d1zdha_
    protein/RNA complex; complexed with br

Details for d1e6tc_

PDB Entry: 1e6t (more details), 2.2 Å

PDB Description: ms2-rna hairpin (5bru-5) complex
PDB Compounds: (C:) coat protein

SCOPe Domain Sequences for d1e6tc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6tc_ d.85.1.1 (C:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOPe Domain Coordinates for d1e6tc_:

Click to download the PDB-style file with coordinates for d1e6tc_.
(The format of our PDB-style files is described here.)

Timeline for d1e6tc_: