Lineage for d1dgaa4 (1dga A:147-375)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2491251Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2491252Protein Actin [53073] (10 species)
  7. 2491518Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [53076] (7 PDB entries)
  8. 2491524Domain d1dgaa4: 1dga A:147-375 [302330]
    Other proteins in same PDB: d1dgag_
    automated match to d1nm1a2
    complexed with atp, ca, mg, so4

Details for d1dgaa4

PDB Entry: 1dga (more details), 1.93 Å

PDB Description: structure of dictyostelium discoideum actin complexed with mg atp and human gelsolin segment 1.
PDB Compounds: (A:) protein (actin)

SCOPe Domain Sequences for d1dgaa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgaa4 c.55.1.1 (A:147-375) Actin {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
rttgivmdsgdgvshtvpiyegyalphailrldlagrdltdymmkiltergysftttaer
eivrdikeklayvaldfeqemataasssaleksyelpdgqvitignerfrcpealfqpsf
lgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgiadrmnkeltalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskeeydesgpsivhrkcf

SCOPe Domain Coordinates for d1dgaa4:

Click to download the PDB-style file with coordinates for d1dgaa4.
(The format of our PDB-style files is described here.)

Timeline for d1dgaa4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dgaa3
View in 3D
Domains from other chains:
(mouse over for more information)
d1dgag_