Lineage for d1cuma_ (1cum A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528714Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2528715Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2528716Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)
  6. 2528717Protein Flavin reductase P (NADPH:FMN oxidoreductase) [55473] (2 species)
  7. 2528725Species Vibrio harveyi [TaxId:669] [55474] (3 PDB entries)
  8. 2528728Domain d1cuma_: 1cum A: [302298]
    automated match to d1bkja_
    complexed with fmn, po4

Details for d1cuma_

PDB Entry: 1cum (more details), 1.8 Å

PDB Description: nadph:fmn oxidoreductase from vibrio harveyi
PDB Compounds: (A:) nadph-flavin oxidoreductase

SCOPe Domain Sequences for d1cuma_:

Sequence, based on SEQRES records: (download)

>d1cuma_ d.90.1.1 (A:) Flavin reductase P (NADPH:FMN oxidoreductase) {Vibrio harveyi [TaxId: 669]}
nntietilahrsirkftavpitdeqrqtiiqaglaassssmlqvvsivrvtdsekrnela
qfagnqayvesaaeflvfcidyqrhatinpdvqadfteltligavdsgimaqncllaaes
mglggvyigglrnsaaqvdellglpensavlfgmclghpdqnpevkprlpahvvvhenqy
qelnlddiqsydqtmqayyasrtsnqklstwsqevtgklagesrphilpylnskglakr

Sequence, based on observed residues (ATOM records): (download)

>d1cuma_ d.90.1.1 (A:) Flavin reductase P (NADPH:FMN oxidoreductase) {Vibrio harveyi [TaxId: 669]}
nntietilahrsirkftavpitdeqrqtiiqaglaassssmlqvvsivrvtdsekrnela
qfagnqayvesaaeflvfcidyqrhatinpdvqadfteltligavdsgimaqncllaaes
mglggvyigglrnsaaqvdellglpensavlfgmclghpdqnpevkprlpahvvvhenqy
qelnlddiqsydqtmqayystwsqevtgklagesrphilpylnskglakr

SCOPe Domain Coordinates for d1cuma_:

Click to download the PDB-style file with coordinates for d1cuma_.
(The format of our PDB-style files is described here.)

Timeline for d1cuma_: