PDB entry 1cum

View 1cum on RCSB PDB site
Description: nadph:fmn oxidoreductase from vibrio harveyi
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1996-06-04, released 1997-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 1997-11-12, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nadph-flavin oxidoreductase
    Species: Vibrio harveyi
    Gene: VIBRIO HARVEYI NADPH:FMN OXIDOREDUCTASE
    Database cross-references and differences (RAF-indexed):
    • GB U08996 (209-239)
    Domains in SCOPe 2.07: d1cuma_
  • Chain 'B':
    Compound: nadph-flavin oxidoreductase
    Species: Vibrio harveyi
    Gene: VIBRIO HARVEYI NADPH:FMN OXIDOREDUCTASE
    Database cross-references and differences (RAF-indexed):
    • GB U08996 (209-239)
    Domains in SCOPe 2.07: d1cumb_
  • Heterogens: PO4, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cumA (A:)
    mnntietilahrsirkftavpitdeqrqtiiqaglaassssmlqvvsivrvtdsekrnel
    aqfagnqayvesaaeflvfcidyqrhatinpdvqadfteltligavdsgimaqncllaae
    smglggvyigglrnsaaqvdellglpensavlfgmclghpdqnpevkprlpahvvvhenq
    yqelnlddiqsydqtmqayyasrtsnqklstwsqevtgklagesrphilpylnskglakr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cumA (A:)
    nntietilahrsirkftavpitdeqrqtiiqaglaassssmlqvvsivrvtdsekrnela
    qfagnqayvesaaeflvfcidyqrhatinpdvqadfteltligavdsgimaqncllaaes
    mglggvyigglrnsaaqvdellglpensavlfgmclghpdqnpevkprlpahvvvhenqy
    qelnlddiqsydqtmqayystwsqevtgklagesrphilpylnskglakr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cumB (B:)
    mnntietilahrsirkftavpitdeqrqtiiqaglaassssmlqvvsivrvtdsekrnel
    aqfagnqayvesaaeflvfcidyqrhatinpdvqadfteltligavdsgimaqncllaae
    smglggvyigglrnsaaqvdellglpensavlfgmclghpdqnpevkprlpahvvvhenq
    yqelnlddiqsydqtmqayyasrtsnqklstwsqevtgklagesrphilpylnskglakr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cumB (B:)
    nntietilahrsirkftavpitdeqrqtiiqaglaassssmlqvvsivrvtdsekrnela
    qfagnqayvesaaeflvfcidyqrhatinpdvqadfteltligavdsgimaqncllaaes
    mglggvyigglrnsaaqvdellglpensavlfgmclghpdqnpevkprlpahvvvhenqy
    qelnlddiqsydqtmqayystwsqevtgklagesrphilpylnskglakr