Lineage for d1evza2 (1evz A:9-197)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 688157Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (17 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 688221Protein Glycerol-3- phosphate dehydrogenase [51881] (2 species)
  7. 688225Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51882] (7 PDB entries)
  8. 688233Domain d1evza2: 1evz A:9-197 [30216]
    Other proteins in same PDB: d1evza1
    complexed with mys, nah

Details for d1evza2

PDB Entry: 1evz (more details), 2.8 Å

PDB Description: crystal structure of leishmania mexicana glycerol-3-phosphate dehydrogenase in complex with nad
PDB Compounds: (A:) glycerol-3-phosphate dehydrogenase

SCOP Domain Sequences for d1evza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evza2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
kdellylnkavvfgsgafgtalamvlskkcrevcvwhmneeevrlvnekrenvlflkgvq
lasnitftsdvekayngaeiilfviptqflrgffeksggnliayakekqvpvlvctkgie
rstlkfpaeiigeflpspllsvlagpsfaievatgvftcvsiasadinvarrlqrimstg
drsfvcwat

SCOP Domain Coordinates for d1evza2:

Click to download the PDB-style file with coordinates for d1evza2.
(The format of our PDB-style files is described here.)

Timeline for d1evza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1evza1