Lineage for d1ldnd1 (1ldn D:15-162)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) 
Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins) Protein Lactate dehydrogenase [51859] (10 species) 
Species Bacillus stearothermophilus [TaxId:1422] [51864] (3 PDB entries) 
Domain d1ldnd1: 1ldn D:15-162 [30169]
Other proteins in same PDB: d1ldna2, d1ldnb2, d1ldnc2, d1ldnd2, d1ldne2, d1ldnf2, d1ldng2, d1ldnh2
Details for d1ldnd1
PDB Entry: 1ldn (more details), 2.5 Å
PDB Description: structure of a ternary complex of an allosteric lactate dehydrogenase from bacillus stearothermophilus at 2.5 angstroms resolution
SCOP Domain Sequences for d1ldnd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldnd1 c.2.1.5 (D:15-162) Lactate dehydrogenase {Bacillus stearothermophilus}
mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
vatnpvdiltyatwkfsglphervigsg
SCOP Domain Coordinates for d1ldnd1:
Click to download the PDB-style file with coordinates for d1ldnd1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ldnd1:
View in 3D
