Lineage for d1ldnh1 (1ldn H:15-162)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66781Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins)
  6. 66788Protein Lactate dehydrogenase [51859] (10 species)
  7. 66789Species Bacillus stearothermophilus [TaxId:1422] [51864] (3 PDB entries)
  8. 66797Domain d1ldnh1: 1ldn H:15-162 [30173]
    Other proteins in same PDB: d1ldna2, d1ldnb2, d1ldnc2, d1ldnd2, d1ldne2, d1ldnf2, d1ldng2, d1ldnh2

Details for d1ldnh1

PDB Entry: 1ldn (more details), 2.5 Å

PDB Description: structure of a ternary complex of an allosteric lactate dehydrogenase from bacillus stearothermophilus at 2.5 angstroms resolution

SCOP Domain Sequences for d1ldnh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldnh1 c.2.1.5 (H:15-162) Lactate dehydrogenase {Bacillus stearothermophilus}
mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
vatnpvdiltyatwkfsglphervigsg

SCOP Domain Coordinates for d1ldnh1:

Click to download the PDB-style file with coordinates for d1ldnh1.
(The format of our PDB-style files is described here.)

Timeline for d1ldnh1: