SCOPe 2.08: Domain d9ldbb1: 9ldb B:1-162

Lineage for d9ldbb1 (9ldb B:1-162)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (19 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51860] (3 PDB entries)

8. Domain d9ldbb1: 9ldb B:1-162 [30157]
   Other proteins in same PDB: d9ldba2, d9ldbb2
   complexed with nad, oxm, so4

Details for d9ldbb1

PDB Entry: 9ldb, 2.2 Å

PDB Description: design and synthesis of new enzymes based on the lactate dehydrogenase framework

PDB Compounds: (B:) lactate dehydrogenase

SCOPe Domain Sequences for d9ldbb1:

Sequence; same for both SEQRES and ATOM records:

>d9ldbb1 c.2.1.5 (B:1-162) Lactate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
atlkdqlihnllkeehvphnkitvvgvgavgmacaisilmkeladeialvdvmedklkge
mmdlqhgslflrtpkivsgkdynvtansrlvvitagarqqegesrlnlvqrnvnifkfii
pnivkyspnckllvvsnpvdiltyvawkisgfpknrvig

Timeline for d9ldbb1:

• d9ldbb1 first appeared (with stable ids) in SCOP 1.55
  
• d9ldbb1 appears in SCOPe 2.07