Lineage for d1hyhb1 (1hyh B:21-166)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66781Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins)
  6. 66782Protein L-2-hydroxyisocapronate dehydrogenase, L-HICDH [51857] (1 species)
  7. 66783Species Lactobacillus confusus [TaxId:1583] [51858] (1 PDB entry)
  8. 66785Domain d1hyhb1: 1hyh B:21-166 [30151]
    Other proteins in same PDB: d1hyha2, d1hyhb2, d1hyhc2, d1hyhd2

Details for d1hyhb1

PDB Entry: 1hyh (more details), 2.2 Å

PDB Description: crystal structure of l-2-hydroxyisocaproate dehydrogenase from lactobacillus confusus at 2.2 angstroms resolution-an example of strong asymmetry between subunits

SCOP Domain Sequences for d1hyhb1:

Sequence, based on SEQRES records: (download)

>d1hyhb1 c.2.1.5 (B:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus}
arkigiiglgnvgaavahgliaqgvaddyvfidaneakvkadqidfqdamanleahgniv
indwaaladadvvistlgniklqqdnptgdrfaelkftssmvqsvgtnlkesgfhgvlvv
isnpvdvitalfqhvtgfpahkvigt

Sequence, based on observed residues (ATOM records): (download)

>d1hyhb1 c.2.1.5 (B:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus}
arkigiiglgnvgaavahgliaqgvaddyvfidaneakvkadqidfqdamanleahgniv
indwaaladadvvistlgniklqqfaelkftssmvqsvgtnlkesgfhgvlvvisnpvdv
italfqhvtgfpahkvigt

SCOP Domain Coordinates for d1hyhb1:

Click to download the PDB-style file with coordinates for d1hyhb1.
(The format of our PDB-style files is described here.)

Timeline for d1hyhb1: