Lineage for d1hyhd2 (1hyh D:167-329)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily) Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) 
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins) 
Protein L-2-hydroxyisocapronate dehydrogenase, L-HICDH [56337] (1 species) Species Lactobacillus confusus [TaxId:1583] [56338] (1 PDB entry) 
Domain d1hyhd2: 1hyh D:167-329 [42120]
Other proteins in same PDB: d1hyha1, d1hyhb1, d1hyhc1, d1hyhd1
Details for d1hyhd2
PDB Entry: 1hyh (more details), 2.2 Å
PDB Description: crystal structure of l-2-hydroxyisocaproate dehydrogenase from lactobacillus confusus at 2.2 angstroms resolution-an example of strong asymmetry between subunits
SCOP Domain Sequences for d1hyhd2:
Sequence, based on SEQRES records: (download)
>d1hyhd2 d.162.1.1 (D:167-329) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus}
gtlldtarmqravgeafdldprsvsgynlgehgnsqfvawstvrvmgqpivtladagdid
laaieeearkggftvlngkgytsygvatsairiakavmadahaelvvsnrrddmgmylsy
paiigrdgvlaettldlttdeqekllqsrdyiqqrfdeivdtl
Sequence, based on observed residues (ATOM records): (download)
>d1hyhd2 d.162.1.1 (D:167-329) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus}
gtlldtarmqravgeafdldprsvsgynlgehgnsqfvawstvrvmgqpivtladaidla
aieeearkggftvlngkgytsygvatsairiakavmadahaelvvsnrrddmgmylsypa
iigrdgvlaettldlttdeqekllqsrdyiqqrfdeivdtl
SCOP Domain Coordinates for d1hyhd2:
Click to download the PDB-style file with coordinates for d1hyhd2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hyhd2:
View in 3D
