Lineage for d1b8pa1 (1b8p A:3-158)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 575610Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
  6. 575732Protein Malate dehydrogenase [51849] (12 species)
  7. 575733Species Aquaspirillum arcticum [TaxId:87645] [51856] (3 PDB entries)
  8. 575734Domain d1b8pa1: 1b8p A:3-158 [30147]
    Other proteins in same PDB: d1b8pa2

Details for d1b8pa1

PDB Entry: 1b8p (more details), 1.9 Å

PDB Description: malate dehydrogenase from aquaspirillum arcticum

SCOP Domain Sequences for d1b8pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8pa1 c.2.1.5 (A:3-158) Malate dehydrogenase {Aquaspirillum arcticum}
ktpmrvavtgaagqicysllfriangdmlgkdqpvilqlleipnekaqkalqgvmmeidd
cafpllagmtahadpmtafkdadvallvgarprgpgmerkdlleanaqiftvqgkaidav
asrnikvlvvgnpantnayiamksapslpaknftam

SCOP Domain Coordinates for d1b8pa1:

Click to download the PDB-style file with coordinates for d1b8pa1.
(The format of our PDB-style files is described here.)

Timeline for d1b8pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b8pa2