Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Malate dehydrogenase [51849] (13 species) |
Species Aquaspirillum arcticum [TaxId:87645] [51856] (3 PDB entries) |
Domain d1b8pa1: 1b8p A:3-158 [30147] Other proteins in same PDB: d1b8pa2 |
PDB Entry: 1b8p (more details), 1.9 Å
SCOPe Domain Sequences for d1b8pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b8pa1 c.2.1.5 (A:3-158) Malate dehydrogenase {Aquaspirillum arcticum [TaxId: 87645]} ktpmrvavtgaagqicysllfriangdmlgkdqpvilqlleipnekaqkalqgvmmeidd cafpllagmtahadpmtafkdadvallvgarprgpgmerkdlleanaqiftvqgkaidav asrnikvlvvgnpantnayiamksapslpaknftam
Timeline for d1b8pa1: