Lineage for d1bmdb1 (1bmd B:0-154)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844748Protein Malate dehydrogenase [51849] (13 species)
  7. 2844830Species Thermus flavus [TaxId:274] [51854] (2 PDB entries)
  8. 2844834Domain d1bmdb1: 1bmd B:0-154 [30140]
    Other proteins in same PDB: d1bmda2, d1bmdb2
    complexed with nad

Details for d1bmdb1

PDB Entry: 1bmd (more details), 1.9 Å

PDB Description: determinants of protein thermostability observed in the 1.9 angstroms crystal structure of malate dehydrogenase from the thermophilic bacterium thermus flavus
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d1bmdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmdb1 c.2.1.5 (B:0-154) Malate dehydrogenase {Thermus flavus [TaxId: 274]}
mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc
afpllagleatddpdvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva
kkdvkvlvvgnpantnaliayknapglnprnftam

SCOPe Domain Coordinates for d1bmdb1:

Click to download the PDB-style file with coordinates for d1bmdb1.
(The format of our PDB-style files is described here.)

Timeline for d1bmdb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bmdb2