| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein Malate dehydrogenase [51849] (13 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [51850] (3 PDB entries) |
| Domain d4mdha1: 4mdh A:1-154 [30128] Other proteins in same PDB: d4mdha2, d4mdhb2 complexed with nad, so4 |
PDB Entry: 4mdh (more details), 2.5 Å
SCOPe Domain Sequences for d4mdha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
sepirvlvtgaagqiaysllysigngsvfgkdqpiilvllditpmmgvldgvlmelqdca
lpllkdviatdkeeiafkdldvailvgsmprrdgmerkdllkanvkifkcqgaaldkyak
ksvkvivvgnpantncltasksapsipkenfscl
Timeline for d4mdha1: