Lineage for d5mdha1 (5mdh A:1-154)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118692Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins)
  6. 118753Protein Malate dehydrogenase [51849] (10 species)
  7. 118793Species Pig (Sus scrofa) [TaxId:9823] [51850] (3 PDB entries)
  8. 118798Domain d5mdha1: 5mdh A:1-154 [30126]
    Other proteins in same PDB: d5mdha2, d5mdhb2

Details for d5mdha1

PDB Entry: 5mdh (more details), 2.4 Å

PDB Description: crystal structure of ternary complex of porcine cytoplasmic malate dehydrogenase alpha-ketomalonate and tnad at 2.4 angstroms resolution

SCOP Domain Sequences for d5mdha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa)}
sepirvlvtgaagqiaysllysigngsvfgkdqpiilvllditpmmgvldgvlmelqdca
lpllkdviatdkeeiafkdldvailvgsmprrdgmerkdllkanvkifkcqgaaldkyak
ksvkvivvgnpantncltasksapsipkenfscl

SCOP Domain Coordinates for d5mdha1:

Click to download the PDB-style file with coordinates for d5mdha1.
(The format of our PDB-style files is described here.)

Timeline for d5mdha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5mdha2