SCOPe 2.07: Domain d4wura1: 4wur A:3-61

Lineage for d4wura1 (4wur A:3-61)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Human coronavirus emc [TaxId:1263720] [311463] (1 PDB entry)

8. Domain d4wura1: 4wur A:3-61 [301219]
   Other proteins in same PDB: d4wura2, d4wurb_
   automated match to d4p16a1
   complexed with ipa, zn

Details for d4wura1

PDB Entry: 4wur, 3.16 Å

PDB Description: the crystal structure of the mers-cov papain-like protease (c111s) with human ubiquitin

PDB Compounds: (A:) papain-like protease

SCOPe Domain Sequences for d4wura1:

Sequence; same for both SEQRES and ATOM records:

>d4wura1 d.15.1.0 (A:3-61) automated matches {Human coronavirus emc [TaxId: 1263720]}
tievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnlt

Timeline for d4wura1:

• d4wura1 first appeared in SCOPe 2.06
  
• d4wura1 appears in the current release, SCOPe 2.08