Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Human coronavirus emc [TaxId:1263720] [311463] (1 PDB entry) |
Domain d4wura1: 4wur A:3-61 [301219] Other proteins in same PDB: d4wura2, d4wurb_ automated match to d4p16a1 complexed with ipa, zn |
PDB Entry: 4wur (more details), 3.16 Å
SCOPe Domain Sequences for d4wura1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wura1 d.15.1.0 (A:3-61) automated matches {Human coronavirus emc [TaxId: 1263720]} tievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnlt
Timeline for d4wura1: