Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Saccharopine reductase [51817] (1 species) |
Species Fungus (Magnaporthe grisea) [TaxId:148305] [51818] (3 PDB entries) |
Domain d1e5qf1: 1e5q F:2-124,F:392-450 [30045] Other proteins in same PDB: d1e5qa2, d1e5qb2, d1e5qc2, d1e5qd2, d1e5qe2, d1e5qf2, d1e5qg2, d1e5qh2 complexed with ndp, shr |
PDB Entry: 1e5q (more details), 2.1 Å
SCOPe Domain Sequences for d1e5qf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e5qf1 c.2.1.3 (F:2-124,F:392-450) Saccharopine reductase {Fungus (Magnaporthe grisea) [TaxId: 148305]} atksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvnddaa ldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvmn eigXysamaklvgvpcavavkfvldgtisdrgvlapmnskindplmkelkekygieckek vva
Timeline for d1e5qf1: