Lineage for d2gd1r1 (2gd1 R:0-148,R:313-333)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175469Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (12 proteins)
  6. 175557Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (13 species)
  7. 175566Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (6 PDB entries)
  8. 175586Domain d2gd1r1: 2gd1 R:0-148,R:313-333 [29981]
    Other proteins in same PDB: d2gd1o2, d2gd1p2, d2gd1q2, d2gd1r2

Details for d2gd1r1

PDB Entry: 2gd1 (more details), 2.5 Å

PDB Description: coenzyme-induced conformational changes in glyceraldehyde-3-phosphate dehydrogenase from bacillus stearothermophillus

SCOP Domain Sequences for d2gd1r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gd1r1 c.2.1.3 (R:0-148,R:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

SCOP Domain Coordinates for d2gd1r1:

Click to download the PDB-style file with coordinates for d2gd1r1.
(The format of our PDB-style files is described here.)

Timeline for d2gd1r1: