Lineage for d1dfhb_ (1dfh B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308075Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (33 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 308243Protein Enoyl-ACP reductase [51791] (4 species)
  7. 308244Species Escherichia coli [TaxId:562] [51794] (12 PDB entries)
  8. 308256Domain d1dfhb_: 1dfh B: [29930]
    complexed with nad, tdb

Details for d1dfhb_

PDB Entry: 1dfh (more details), 2.2 Å

PDB Description: x-ray structure of escherichia coli enoyl reductase with bound nad and thieno-diazaborine

SCOP Domain Sequences for d1dfhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfhb_ c.2.1.2 (B:) Enoyl-ACP reductase {Escherichia coli}
gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
gevvhvdggfsiaamne

SCOP Domain Coordinates for d1dfhb_:

Click to download the PDB-style file with coordinates for d1dfhb_.
(The format of our PDB-style files is described here.)

Timeline for d1dfhb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dfha_