Lineage for d1dfha_ (1dfh A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1576689Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1577205Protein Enoyl-ACP reductase [51791] (11 species)
  7. 1577222Species Escherichia coli [TaxId:562] [51794] (13 PDB entries)
  8. 1577241Domain d1dfha_: 1dfh A: [29929]
    complexed with nad, tdb

Details for d1dfha_

PDB Entry: 1dfh (more details), 2.2 Å

PDB Description: x-ray structure of escherichia coli enoyl reductase with bound nad and thieno-diazaborine
PDB Compounds: (A:) enoyl acyl carrier protein reductase

SCOPe Domain Sequences for d1dfha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfha_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]}
gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
gevvhvdggfsiaamne

SCOPe Domain Coordinates for d1dfha_:

Click to download the PDB-style file with coordinates for d1dfha_.
(The format of our PDB-style files is described here.)

Timeline for d1dfha_: