| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) ![]() |
| Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (33 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
| Protein Enoyl-ACP reductase [51791] (4 species) |
| Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (4 PDB entries) |
| Domain d1bvrc_: 1bvr C: [29915] |
PDB Entry: 1bvr (more details), 2.8 Å
SCOP Domain Sequences for d1bvrc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvrc_ c.2.1.2 (C:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA}
tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
vcallsdwlpattgdiiyadggahtqll
Timeline for d1bvrc_: