Lineage for d1bvrc_ (1bvr C:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175154Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (28 proteins)
  6. 175304Protein Enoyl-ACP reductase [51791] (3 species)
  7. 175334Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (4 PDB entries)
  8. 175340Domain d1bvrc_: 1bvr C: [29915]

Details for d1bvrc_

PDB Entry: 1bvr (more details), 2.8 Å

PDB Description: m.tb. enoyl-acp reductase (inha) in complex with nad+ and c16-fatty- acyl-substrate

SCOP Domain Sequences for d1bvrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvrc_ c.2.1.2 (C:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA}
tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
vcallsdwlpattgdiiyadggahtqll

SCOP Domain Coordinates for d1bvrc_:

Click to download the PDB-style file with coordinates for d1bvrc_.
(The format of our PDB-style files is described here.)

Timeline for d1bvrc_: