SCOP 1.65: Domain d1enz__: 1enz -

Lineage for d1enz__ (1enz -)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (33 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Enoyl-ACP reductase [51791] (4 species)

7. Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (4 PDB entries)

8. Domain d1enz__: 1enz - [29912]
   complexed with nad; mutant

Details for d1enz__

PDB Entry: 1enz, 2.7 Å

PDB Description: crystal structure and function of the isoniazid target of mycobacterium tuberculosis

SCOP Domain Sequences for d1enz__:

Sequence; same for both SEQRES and ATOM records:

>d1enz__ c.2.1.2 (-) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA}
aglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
eldvqneehlaslagrvteaigagnkldgvvhaigfmpqtgmginpffdapyadvskgih
isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
vcallsdwlpattgdiiyadggahtqll

Timeline for d1enz__:

• d1enz__ first appeared (with stable ids) in SCOP 1.55
  
• d1enz__ appears in SCOP 1.63
  
• d1enz__ appears in SCOP 1.67
  
• d1enz__ appears in the current release, SCOPe 2.08, called d1enza_