Lineage for d1edoa_ (1edo A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 387288Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (40 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 387352Protein beta-keto acyl carrier protein reductase [51788] (3 species)
  7. 387368Species Oil seed rape (Brassica napus) [TaxId:3708] [51789] (1 PDB entry)
  8. 387369Domain d1edoa_: 1edo A: [29896]
    complexed with nap

Details for d1edoa_

PDB Entry: 1edo (more details), 2.3 Å

PDB Description: the x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with nadp+

SCOP Domain Sequences for d1edoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus)}
spvvvvtgasrgigkaialslgkagckvlvnyarsakaaeevskqieayggqaitfggdv
skeadveammktaidawgtidvvvnnagitrdtllirmkksqwdevidlnltgvflctqa
atkimmkkrkgriiniasvvglignigqanyaaakagvigfsktaaregasrninvnvvc
pgfiasdmtaklgedmekkilgtiplgrtgqpenvaglveflalspaasyitgqaftidg
giai

SCOP Domain Coordinates for d1edoa_:

Click to download the PDB-style file with coordinates for d1edoa_.
(The format of our PDB-style files is described here.)

Timeline for d1edoa_: