Lineage for d1gegb_ (1geg B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2450988Protein meso-2,3-butanediol dehydrogenase [51786] (1 species)
  7. 2450989Species Klebsiella pneumoniae [TaxId:573] [51787] (1 PDB entry)
  8. 2450991Domain d1gegb_: 1geg B: [29889]
    complexed with bme, glc, mg, nad

Details for d1gegb_

PDB Entry: 1geg (more details), 1.7 Å

PDB Description: cryatal structure analysis of meso-2,3-butanediol dehydrogenase
PDB Compounds: (B:) acetoin reductase

SCOPe Domain Sequences for d1gegb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gegb_ c.2.1.2 (B:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]}
kkvalvtgagqgigkaialrlvkdgfavaiadyndatakavaseinqagghavavkvdvs
drdqvfaaveqarktlggfdvivnnagvapstpiesitpeivdkvyninvkgviwgiqaa
veafkkeghggkiinacsqaghvgnpelavyssskfavrgltqtaardlaplgitvngyc
pgivktpmwaeidrqvseaagkplgygtaefakritlgrlsepedvaacvsylaspdsdy
mtgqsllidggmvfn

SCOPe Domain Coordinates for d1gegb_:

Click to download the PDB-style file with coordinates for d1gegb_.
(The format of our PDB-style files is described here.)

Timeline for d1gegb_: