Lineage for d4i55f1 (4i55 F:1-76)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862155Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)
  6. 2862156Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)
  7. 2862157Species Chicken (Gallus gallus) [TaxId:9031] [311384] (188 PDB entries)
  8. 2862241Domain d4i55f1: 4i55 F:1-76 [298259]
    Other proteins in same PDB: d4i55a1, d4i55a2, d4i55b1, d4i55b2, d4i55c1, d4i55c2, d4i55d1, d4i55d2, d4i55e_, d4i55f2, d4i55f3
    automated match to d3tiia1
    complexed with acp, ca, cl, gdp, gtp, mes, mg

Details for d4i55f1

PDB Entry: 4i55 (more details), 2.2 Å

PDB Description: crystal structure of tubulin-stathmin-ttl complex
PDB Compounds: (F:) Tubulin Tyrosine ligase, TTL

SCOPe Domain Sequences for d4i55f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i55f1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d4i55f1:

Click to download the PDB-style file with coordinates for d4i55f1.
(The format of our PDB-style files is described here.)

Timeline for d4i55f1: