Lineage for d1e3ea2 (1e3e A:175-324)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 117974Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)
  6. 117975Protein Alcohol dehydrogenase [51737] (4 species)
  7. 118067Species Mouse (Mus musculus), class II [TaxId:10090] [51740] (3 PDB entries)
  8. 118070Domain d1e3ea2: 1e3e A:175-324 [29759]
    Other proteins in same PDB: d1e3ea1, d1e3eb1

Details for d1e3ea2

PDB Entry: 1e3e (more details), 2.12 Å

PDB Description: mouse class ii alcohol dehydrogenase complex with nadh

SCOP Domain Sequences for d1e3ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3ea2 c.2.1.1 (A:175-324) Alcohol dehydrogenase {Mouse (Mus musculus), class II}
ligcgfssgygaaintakvtpgstcavfglgcvglsaiigckiagasriiaidingekfp
kakalgatdclnpreldkpvqdviteltaggvdysldcagtaqtlkaavdctvlgwgsct
vvgakvdemtiptvdvilgrsingtffggw

SCOP Domain Coordinates for d1e3ea2:

Click to download the PDB-style file with coordinates for d1e3ea2.
(The format of our PDB-style files is described here.)

Timeline for d1e3ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e3ea1