SCOP 1.69: Domain d1adg_2: 1adg 164-339

Lineage for d1adg_2 (1adg 164-339)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (14 proteins)
   N-terminal all-beta domain defines family

6. Protein Alcohol dehydrogenase [51737] (9 species)

7. Species Horse (Equus caballus) [TaxId:9796] [51738] (33 PDB entries)

8. Domain d1adg_2: 1adg 164-339 [29716]
   Other proteins in same PDB: d1adg_1

Details for d1adg_2

PDB Entry: 1adg, 2.7 Å

PDB Description: crystallographic studies of two alcohol dehydrogenase-bound analogs of thiazole-4-carboxamide adenine dinucleotide (tad), the active anabolite of the antitumor agent tiazofurin

SCOP Domain Sequences for d1adg_2:

Sequence; same for both SEQRES and ATOM records:

>d1adg_2 c.2.1.1 (164-339) Alcohol dehydrogenase {Horse (Equus caballus)}
splekvcligcgfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvd
inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq
eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk

Timeline for d1adg_2:

• d1adg_2 first appeared (with stable ids) in SCOP 1.55
  
• d1adg_2 appears in SCOP 1.67
  
• d1adg_2 appears in SCOP 1.71
  
• d1adg_2 appears in the current release, SCOPe 2.08, called d1adga2